Iclaprim mesilate or mesylate

Immunogen Recombinant protein corresponding to myosin light chain, phosphorylatable, fast skeletal muscle Sequence KGTIKKKFLEELLTTQCDRFSQEEIKNMWAAF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

F(ab')2 Anti-Human IgM Fc5&micro Phycoerythrin Antibody is suitable for immunomicroscopy and flow cytometry or FACS analysis as well as other antibody based fluorescent assays requiring extremely low background levels, absence of F(c) mediated

Analysis Note To view the Certificate of Analysis for this product, please visit www.cytiva.

Mse A-Ckn MCAM-FITC 0.5 mg

Mse A-Monkey IgG-AP 1.0 mL

A highly potent, reversible, and substrate competitive membrane-permeable Drosophila Antennapedia homeodomain fused-peptide that selectively inhibits protein kinase G I&#945 (K i = 25 nM). Shown to efficiently translocate into arterial smooth

PrEST Antigen DNAJC18 DnaJ (Hsp40) homolog, subfamily C, mem

PrEST Antigen MECP2 methyl CpG binding protein 2, 100ul UN 1

PrEST Antigen RERGL RERG/RAS-like, 100ul UN 1687 6.1 PG2

PrEST Antigen SMU1 smu-1 suppressor of mec-8 and unc-52 homo

NUNC™ Brand Thernanox®, or TMX coverslips are made from a polymer (in the polyolefin family) that is highly resistant to most chemicals. Thermanox® plastic is resistant to alcohols, aldehydes, hydrocarbons, dilute acids (&lt10%) and dilute alkalis

NUNC™ Brand Thernanox®, or TMX coverslips are made from a polymer (in the polyolefin family) that is highly resistant to most chemicals. Thermanox® plastic is resistant to alcohols, aldehydes, hydrocarbons, dilute acids (&lt10%) and dilute alkalis