Meclocycline

Other Notes remainder cyclohexylideneacetonitrile

Anti-ABCB6 ATP-binding cassette, sub-family B (MDR/TAP), mem

Anti-ABCB6 ATP-binding cassette, sub-family B (MDR/TAP), mem

Anti-c-myc is a monoclonal antibody to c-myc peptide (clone 9E10). Anti-c-myc recognizes the 9E10 epitope sequence (EQKLISEEDL), derived from the human c-myc protein.

Anti-c-myc is a monoclonal antibody to c-myc peptide (clone 9E10). Anti-c-myc recognizes the 9E10 epitope sequence (EQKLISEEDL), derived from the human c-myc protein.

Immunogen Recombinant protein corresponding to mesoderm development candidate 2. Sequence TPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPT Application All Prestige Antibodies Powered by Atlas Antibodies are

Boc-D-Lys-OH

Boc-Lys-OH also known as N &#945-Boc-L-lysine, is an amino acid derivative of lysine which is used in solid phase peptide synthesis. Application Boc-Lys-OH is used as a building block to form peptides that have bioorthogonal reactive groups via

Boc-Lys-OH also known as N &#945-Boc-L-lysine, is an amino acid derivative of lysine which is used in solid phase peptide synthesis. Application Boc-Lys-OH is used as a building block to form peptides that have bioorthogonal reactive groups via

Application Boc-Lys-OH (N&#945-Boc- L -lysine) can be used as a building block to synthesize: A heterotrifunctional peptide-based linker molecule applicable as a bio-labeling reagent. Lysine derivatives of azamacrocycle and anthraquinone.

c-Myc Peptide is a useful for displacement of c-Myc-tagged fusion proteins bound to anti-c-Myc antibodies in immunoassays. The successful inhibition of antibody binding by c-Myc peptide demonstrates binding is specific.

Cell Line Origin Mouse Sp2/0 x Mouse BALB/c spleen Cell Line Description The antibody recognises the 62kDa protein which is the product of the human c-myc gene. There is no cross reaction with the murine c-myc protein or the chicken p110gag-myc