Meclocycline

Other Notes remainder cyclohexylideneacetonitrile

4-hydroxybicyclo[2.2.2]octane-1-carbonitrile.

4-hydroxybicyclo[2.2.2]octane-1-carbonitrile.

4-hydroxybicyclo[2.2.2]octane-1-carbonitrile.

4-hydroxybicyclo[2.2.2]octane-1-carbonitrile.

4-hydroxybicyclo[2.2.2]octane-1-carbonitrile.

Anti-c-myc is a monoclonal antibody to c-myc peptide (clone 9E10). Anti-c-myc recognizes the 9E10 epitope sequence (EQKLISEEDL), derived from the human c-myc protein.

Anti-c-myc is a monoclonal antibody to c-myc peptide (clone 9E10). Anti-c-myc recognizes the 9E10 epitope sequence (EQKLISEEDL), derived from the human c-myc protein.

Immunogen Recombinant protein corresponding to mesoderm development candidate 2. Sequence TPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPT Application All Prestige Antibodies Powered by Atlas Antibodies are

Boc-D-Lys-OH

Boc-Lys-OH also known as N &#945-Boc-L-lysine, is an amino acid derivative of lysine which is used in solid phase peptide synthesis. Application Boc-Lys-OH is used as a building block to form peptides that have bioorthogonal reactive groups via

Boc-Lys-OH also known as N &#945-Boc-L-lysine, is an amino acid derivative of lysine which is used in solid phase peptide synthesis. Application Boc-Lys-OH is used as a building block to form peptides that have bioorthogonal reactive groups via