-
Add to Cart The item has been addedA1729-5UGActivin B human (C15-1314-907)
Price: $890.33List Price: $989.26Biochem/physiol Actions Activin-B is involved in the regulation of a variety of cell functions that overlap the actions of activin-A however, activin-B also regulates many processes that are distinct from activin-A activities. The functional -
Add to Cart The item has been addedAV46061-100ULANTI-BLK
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the middle region of human BLK Application Anti-BLK antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. -
Add to Cart The item has been addedCWA-1132-25ULANTI-HUMAN NESTIN (8B8) COLORWHEEL DYE-READY MAB
Price: $306.73List Price: $340.82ColorWheel ® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheel ® antibody with any ColorWheel ® dye, researchers can quickly and -
Add to Cart The item has been addedHPA002196-25ULANTI-IGFBP7
Price: $540.00List Price: $600.00Insulin-like growth factor binding protein 7 (IGFBP7) belongs to the IGFBP family. It is widely distributed in normal tissues but less available in the cancerous cells. -
Add to Cart The item has been addedABN1661Anti-Membralin (C15-1317-412)
Price: $687.43List Price: $763.81Membralin (UniProt: Q8CIV2 also known as Transmembrane protein 259) is encoded by the Tmem259 (also known as ORF61) gene (Gene ID: 216157) in murine species. Membralin is a highly conserved protein with several transmembrane regions. -
Add to Cart The item has been addedHPA071840-100ULAnti-MROH7
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to maestro heat like repeat family member 7 Sequence GIIILYTILELQKRARDKEETNKKELYESNKHFLGPYNPVSPCQNILRVIEEFGDFLGPQQIKDLLLAALEGLKGSSEAPGKDSREMMQLASEVMLSSV Application All Prestige Antibodies Powered by -
Add to Cart The item has been addedA8706-5MGAvidin from egg white (C15-1214-362)
Price: $464.69List Price: $516.33Avidin is a homotetrameric glycoprotein found in the egg white of birds, reptiles and amphibians. Each subunit is 16 kDa, singly glycosylated and binds to a molecule of biotin with greater affinity and specificity. -
Add to Cart The item has been addedA9275-100MGAvidin from egg white (C15-1214-363)
Price: $1,626.86List Price: $1,807.62Avidin is homotetrameric protein (68kDa) that is obtained from egg whites. This egg protein binds strongly to biotin. -
Add to Cart The item has been addedA9275-10MGAvidin from egg white (C15-1214-364)
Price: $356.33List Price: $395.92Avidin is homotetrameric protein (68kDa) that is obtained from egg whites. This egg protein binds strongly to biotin. -
Add to Cart The item has been addedA9275-1MGAvidin from egg white (C15-1214-365)
Price: $89.53List Price: $99.48Avidin is homotetrameric protein (68kDa) that is obtained from egg whites. This egg protein binds strongly to biotin. -
Add to Cart The item has been addedA9275-25MGAvidin from egg white (C15-1214-366)
Price: $579.43List Price: $643.81Avidin is homotetrameric protein (68kDa) that is obtained from egg whites. This egg protein binds strongly to biotin. -
Add to Cart The item has been addedA9275-2MGAvidin from egg white (C15-1214-367)
Price: $134.88List Price: $149.87Avidin is homotetrameric protein (68kDa) that is obtained from egg whites. This egg protein binds strongly to biotin.
