-
![[asn670, leu671]-amyloid beta/a4 precursor protein 770 fragment 667-676 trifluoroacetate salt](https://cdn11.bigcommerce.com/s-2u2oi3cvy8/images/stencil/500x659/products/845163/673092/cenmed-product-image-placeholder-1-__73298.1717443540.jpg?c=1 "[asn670, leu671]-amyloid beta/a4 precursor protein 770 fragment 667-676 trifluoroacetate salt")
Add to Cart The item has been addedA1972-1MG[Asn670, Leu671]-Amyloid beta/A4 Precursor Protein 770 Fragment 667-676 trifluoroacetate salt
Price: $325.10List Price: $361.22Amino Acid Sequence Ser-Glu-Val-Asn-Leu-Asp-Ala-Glu-Phe-Arg Biochem/physiol Actions Substrate for assaying β-secretase activity that corresponds to the Swedish" Lys-Met/Asn-Leu mutation of the amyloid precursor protein β-secretase" -
Add to Cart The item has been added231005-100MGá-Alanine 7-amido-4-methylcoumarin trifluoroacetate ; 99%, 1
Price: $256.41List Price: $284.90Synonyms: ß-Ala-AMC·TFA Purity Limit: 99% CAS No.: 201847-54-3 Molecular Formula: C13H14N2O3·C2HO2F3 Molecular Weight: 360.32 MDL No.: MFCD00151970 Storage Temperature: Store at 0-8°C -
Add to Cart The item has been addedA0SA5077-1ZANP RESIN, 1GR
Price: $168.70List Price: $187.44Structure confirmed. Will ship with Certificate of Analysis (CoA) -
Add to Cart The item has been addedCBL66Anti-Atrial Natriuretic Peptide Antibody, clone A6
Price: $965.14List Price: $1,072.38Specificity ANP (Whole molecule and residues 4-28) FUSION PARTNER: NSO myeloma cell line Immunogen ANP/BSA conjugate Application Competetive radioimmunoassay (Clinical measurement of circulating ANP levels possibly in conjunction with cyclic GMP) -
Add to Cart The item has been addedHPA067855-100ULAnti-NAT8
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to N-acetyltransferase 8 (putative) Sequence KPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA058269-25Anti-NPPA natriuretic peptide A, 25ul UN 1687 6.1 PG2 (C08-0243-666)
Price: $718.81List Price: $798.67Anti-NPPA natriuretic peptide A, 25ul UN 1687 6.1 PG2 -
Add to Cart The item has been added1701Detergent 8, Low Foaming, Nonionic, 1gallon UN1760 8 PG3 (C08-0201-147)
Price: $239.46List Price: $266.06Detergent 8, Low Foaming, Nonionic, 1gallon UN1760 8 PG3 -
Add to Cart The item has been addedD414-06Duck Plasma NS In Na Heparin 10mL
Price: $658.74List Price: $731.93pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedE0502-5GElastin-Congo red
Price: $672.00List Price: $746.67Elastin−Congo red is a substrate-dye conjugate and is used in agar medium to probe elastase activity. The presence of elastase functionality leads to cleavage of the dye from the elastin substrate. -
Add to Cart The item has been addedD515-06Goose Plasma Sterile In Na Heparin 10mL
Price: $818.02List Price: $908.91pH: normal Immunoelectrophoresis: normal Hemoglobin: normal IgG Concentration: normal -
Add to Cart The item has been addedCDS003175-1GNARINGIN DIHYDROCHALCONE
Price: $181.93List Price: $202.14Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product. -
Add to Cart The item has been addedAPrEST70777-100PrEST Antigen ADAM7 ADAM metallopeptidase domain 7, 100ul UN
Price: $537.65List Price: $597.39PrEST Antigen ADAM7 ADAM metallopeptidase domain 7, 100ul UN
