-
Add to Cart The item has been addedADE000212-1G6-IODO-5-METHOXYPYRIDIN-3-OL (C15-1318-151)
Price: $1,709.14List Price: $1,899.05Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product. -
Add to Cart The item has been addedABC304Anti-Olfactomedin-4/OLFM4 Antibody (C15-1316-688)
Price: $785.14List Price: $872.38OLFM4, also known as Olfactomedin-4, Antiapoptotic protein GW112, G-CSF-stimulated clone 1 protein (hGC-1), or hOLfD, and encoded by the gene OLFM4/GW112 is a multimeric protein that has been found both extracellularly, interacting with cell -
Add to Cart The item has been addedHPA077718-100ULAnti-OLFM4
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to olfactomedin 4 Sequence KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been added14526-500MLO,O'-Bis(2-aminopropyl) polypropylene glycol-block-polyethylene glycol-block-polypropylene glycol (C15-1256-171)
Price: $372.86List Price: $414.29Flash point 160°C (Lit.) Application Modification of polyamides for enhanced hydrophilicity. -
Add to Cart The item has been added14529-100G-FO,O'-Bis(2-aminopropyl) polypropylene glycol-block-polyethylene glycol-block-polypropylene glycol (C15-1256-173)
Price: $141.66List Price: $157.40( O , O ′ -bis(2-aminopropyl) polypropylene glycol- block -polyethylene glycol- block -polypropylene glycol (Jeffamine ® ED-2003) is a functional oligomer with a high content of polypropylene glycol (PEO). {3} Application Jeffamine -
Add to Cart The item has been added14529-500G-FO,O'-Bis(2-aminopropyl) polypropylene glycol-block-polyethylene glycol-block-polypropylene glycol (C15-1256-174)
Price: $383.88List Price: $426.53( O , O ′ -bis(2-aminopropyl) polypropylene glycol- block -polyethylene glycol- block -polypropylene glycol (Jeffamine ® ED-2003) is a functional oligomer with a high content of polypropylene glycol (PEO). {3} Application Jeffamine -
Add to Cart The item has been addedAPrEST85466-100PrEST Antigen OLFM1 olfactomedin 1, 100ul UN 1687 6.1 PG2
Price: $537.65List Price: $597.39PrEST Antigen OLFM1 olfactomedin 1, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedAPrEST82565-100PrEST Antigen OLFM2 olfactomedin 2, 100ul UN 1687 6.1 PG2
Price: $537.65List Price: $597.39PrEST Antigen OLFM2 olfactomedin 2, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedAPrEST94032-100PrEST Antigen OLFM4 olfactomedin 4, 100ul UN 1687 6.1 PG2
Price: $537.65List Price: $597.39PrEST Antigen OLFM4 olfactomedin 4, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedAPrEST80799-100PrEST Antigen OLFML1 olfactomedin-like 1, 100ul UN 1687 6.1
Price: $537.65List Price: $597.39PrEST Antigen OLFML1 olfactomedin-like 1, 100ul UN 1687 6.1 -
Add to Cart The item has been addedAPrEST75399-100PrEST Antigen OLFML2A olfactomedin-like 2A, 100ul UN 1687 6. (C08-0210-163)
Price: $537.65List Price: $597.39PrEST Antigen OLFML2A olfactomedin-like 2A, 100ul UN 1687 6. -
Add to Cart The item has been addedAPrEST75400-100PrEST Antigen OLFML2A olfactomedin-like 2A, 100ul UN 1687 6. (C08-0210-164)
Price: $537.65List Price: $597.39PrEST Antigen OLFML2A olfactomedin-like 2A, 100ul UN 1687 6.
