Polymyxin b

Protein A Magnetic Beads are densely coated with Protein A. They are utilized in the magnetic separation and isolation of antibodies from serum, cell culture supernatants, ascites, or antibody-labeled components.

Aflatoxin B1 is a mycotoxin found to be hepatocarcinogenic in nature. It has a strong affinity for the deoxyribonucleic acid (DNA) and binds to both native and denatured deoxyribonucleic acid (DNA) as indicated by spectroscopy and equilibrium

Application Refer to the product&#8242s Certificate of Analysis for more information on a suitable instrument technique. Contact Technical Service for further support.

Application Refer to the product&#8242s Certificate of Analysis for more information on a suitable instrument technique. Contact Technical Service for further support.

Analysis Note For more information please see: ERMAC057 Legal Information ERM is a registered trademark of European Commission

Immunogen Synthetic peptide directed towards the middle region of human BHLHB2 Biochem/physiol Actions BHLHB2 is a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP.

Goat polyclonal antibody supplied as lyophilized undiluted serum. Recognizes cholera toxin B-subunit.

Methyl-CpG-binding domain protein 6 (UniProt: Q96DN6 also known as Methyl-CpG-binding protein MBD6) is encoded by the MBD6 (also known as KIAA1887) gene (Gene ID: 114785) in human. The methyl-CpG-binding domain (MBD) proteins are primary

Methyl-CpG-binding domain protein 6 (UniProt: Q96DN6 also known as Methyl-CpG-binding protein MBD6) is encoded by the MBD6 (also known as KIAA1887) gene (Gene ID: 114785) in human. The methyl-CpG-binding domain (MBD) proteins are primary

Immunogen Recombinant protein corresponding to MYC binding protein 2, E3 ubiquitin protein ligase Sequence CYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSL Application All Prestige Antibodies Powered by

PBX2 is a homeobox transcription factor that shares homology with the human proto-oncogene, PBX1 . Studies have reported that PBX2 forms triple complexes with HOXA9 and MEIS1 in myeloid cells .

RAN, a small GTP binding protein, belonging to the RAS superfamily is involved in the translocation of RNA and proteins through the nuclear pore complex and participate in the control of DNA synthesis and cell cycle progression. Antisense QAGR