-
Add to Cart The item has been addedCDS000009-10MG6-AMINO-9H-PURIN-2-OL
Price: $165.74List Price: $184.16Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product. -
![7-(2-chlorobenzyl)-1 3-dimethyl-8-{2-[1-(3-nitrophenyl)ethylidene]hydr azino}-3 7-dihydro-1h-purine-2 6-dione](https://cdn11.bigcommerce.com/s-2u2oi3cvy8/images/stencil/500x659/products/859758/687687/cenmed-product-image-placeholder-1-__55322.1717448799.jpg?c=1 "7-(2-chlorobenzyl)-1 3-dimethyl-8-{2-[1-(3-nitrophenyl)ethylidene]hydr azino}-3 7-dihydro-1h-purine-2 6-dione")
Add to Cart The item has been addedL260908-1EA7-(2-CHLOROBENZYL)-1 3-DIMETHYL-8-{2-[1-(3-NITROPHENYL)ETHYLIDENE]HYDR AZINO}-3 7-DIHYDRO-1H-PURINE-2 6-DIONE
Price: $69.66List Price: $77.40Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of rare and unique chemicals. Sigma-Aldrich does not collect analytical data for this product. -
Add to Cart The item has been addedHPA070820-100ULAnti-PEA15
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to phosphoprotein enriched in astrocytes 15 Sequence PPWPGQTSPVMAEYGTLLQDLTNNITLEDLGQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedAB3258Anti-Puromycin Sensitive Aminopeptidase Antibody (C15-1316-048)
Price: $687.43List Price: $763.81Specificity Recognizes puromycin sensitive aminopeptidase. SPECIES REACTIVITIES: It is expected that the antibody may react with other species. -
Add to Cart The item has been addedCC065Human Tenascin-C Purified Protein
Price: $840.09List Price: $933.43Product Source: Human glioma cell line (U251). Purified Human Tenascin-C Protien. -
Add to Cart The item has been added492899-15KUNuclease, Staphylococcus aureus
Price: $519.43List Price: $577.14Native Stapylococcus aureus nuclease. Cleaves RNA and DNA to produce oligo- and mononucleotides with terminal 3′-phosphate groups. -
Add to Cart The item has been added47033PUFA NO.1 MARINE SOURCE 100MG NEAT (C15-1303-740)
Price: $997.71List Price: $1,108.57PUFA No.1 is a complex qualitative standard mixture.
