-
Add to Cart The item has been addedHPA076019-100ULAnti-RHOF
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ras homolog family member F, filopodia associated Sequence LLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been added5306540001C-REL INHIBITOR IT-603 (C15-1305-027)
Price: $368.52List Price: $409.47A cell-permeable benzylidene-thioxo-imidazolidinone compund that directly and reversibly binds to c-Rel to change its conformation and blocks its DNA binding and transcriptional activity (IC 50 = 3 µM in EMSA). Shows good selectivity over Oct1 -
Add to Cart The item has been addedAPrEST89187-100PrEST Antigen RBBP4 retinoblastoma binding protein 4, 100ul (C08-0221-829)
Price: $537.65List Price: $597.39PrEST Antigen RBBP4 retinoblastoma binding protein 4, 100ul -
Add to Cart The item has been addedAPrEST90476-100PrEST Antigen RBBP4 retinoblastoma binding protein 4, 100ul (C08-0222-966)
Price: $537.65List Price: $597.39PrEST Antigen RBBP4 retinoblastoma binding protein 4, 100ul -
Add to Cart The item has been addedAPrEST71627-100PrEST Antigen RETSAT retinol saturase (all-trans-retinol 13, (C08-0206-990)
Price: $537.65List Price: $597.39PrEST Antigen RETSAT retinol saturase (all-trans-retinol 13, -
Add to Cart The item has been addedAPrEST89528-100PrEST Antigen RETSAT retinol saturase (all-trans-retinol 13, (C08-0222-130)
Price: $537.65List Price: $597.39PrEST Antigen RETSAT retinol saturase (all-trans-retinol 13,
