-
Add to Cart The item has been addedHPA057997-100ULAnti-MED26
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to mediator complex subunit 26 Sequence PGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
![anti-paxillin antibody, phospho-specific [ser178] (c15-1315-935)](https://cdn11.bigcommerce.com/s-2u2oi3cvy8/images/stencil/500x659/products/1144549/969265/cenmed-product-image-placeholder-1-__53772.1717750712.jpg?c=1 "anti-paxillin antibody, phospho-specific [ser178] (c15-1315-935)")
Add to Cart The item has been addedAB1962Anti-Paxillin Antibody, phospho-specific [Ser178] (C15-1315-935)
Price: $759.43List Price: $843.81Paxillin, a focal adhesion protein, is involved in focal adhesion formation during cell adhesion and migration. Paxillin contains LD motifs, LIM domains, and SH3-/SH2-binding domains that participate in a variety of protein-protein interactions -
Add to Cart The item has been added90102523-1VLDOCL1 (S+L-)CANINEKIDNEY MOLONEY SARCOMA VIRU (C15-1311-824)
Price: $1,630.29List Price: $1,811.43Other Notes Additional freight & handling charges may be applicable for Asia-Pacific shipments. Please check with your local Customer Service representative for more information. -
Add to Cart The item has been added17-10155LentiBrite Paxillin-RFP Lentiviral Biosensor
Price: $1,176.00List Price: $1,306.67Read our application note in Nature Methods ! http://www.nature.
