-
Add to Cart The item has been added301450-1G4-Bromomethyl-6,7-dimethoxycoumarin
Price: $547.90List Price: $608.78Application 4-Bromomethyl-6,7-dimethoxycoumarin was used as fluorescent labeling reagent for the reversed-phase HPLC separation and detection of carboxylic acids. It was also used as derivatization reagent: for quantitation of clofibric, bezafibric -
Add to Cart The item has been added116238-1G5,7-Dimethoxycoumarin
Price: $246.32List Price: $273.695,7-dimethoxycoumarin is isolated and identified from leaves and fruits of Pelea anisata H. Mann, a plant whose fruit are used in the construction of mohikana leis . -
Add to Cart The item has been added254886-1G6,7-Dimethoxycoumarin (C15-1207-584)
Price: $613.97List Price: $682.196,7-Dimethoxycoumarin inhibits the in vitro growth of Phytophthora citrophthora, Verticillium dahliae, Penicillium digitatum, P. italicum, Colletotrichum gloeosporioides, Diplodia natalensis and Hendersonula toruloidea . -
Add to Cart The item has been added254886-250MG6,7-Dimethoxycoumarin (C15-1207-585)
Price: $296.63List Price: $329.596,7-Dimethoxycoumarin inhibits the in vitro growth of Phytophthora citrophthora, Verticillium dahliae, Penicillium digitatum, P. italicum, Colletotrichum gloeosporioides, Diplodia natalensis and Hendersonula toruloidea . -
Add to Cart The item has been addedIDF00050-1G7-DIETHYLAMINO-3-FORMYLCOUMARIN
Price: $573.69List Price: $637.43Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product. -
Add to Cart The item has been addedIDF00025-1G7-METHYL-6-NITROCOUMARIN
Price: $222.86List Price: $247.62Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product. -
Add to Cart The item has been addedHPA061069-100ULAnti-CFAP77
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cilia and flagella associated protein 77 Sequence AVKAGLVTARENLLYRQLNDIRISDQDDRRMKKEPPPLPPNMTFGIRARPSTPFFDLLQHRYLQLWVQEQKATQKAIKL Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA001586-100ULANTI-RRP7A antibody produced in rabbit (C15-1445-345)
Price: $879.43List Price: $977.14Immunogen Ribosomal RNA-processing protein 7 homolog A (Gastric cancer antigen Zg14) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA046768-100ULAnti-RRP7A antibody produced in rabbit (C15-1458-987)
Price: $928.29List Price: $1,031.43Immunogen ribosomal RNA processing 7 homolog A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAPrEST82343-100PrEST Antigen SRL sarcalumenin, 100ul UN 1687 6.1 PG2 (C08-0215-975)
Price: $537.65List Price: $597.39PrEST Antigen SRL sarcalumenin, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedAPrEST82344-100PrEST Antigen SRL sarcalumenin, 100ul UN 1687 6.1 PG2 (C08-0215-976)
Price: $537.65List Price: $597.39PrEST Antigen SRL sarcalumenin, 100ul UN 1687 6.1 PG2
