-
Add to Cart The item has been addedHPA054814-25Anti-SERTM1 serine-rich and transmembrane domain containing (C08-0242-660)
Price: $718.81List Price: $798.67Anti-SERTM1 serine-rich and transmembrane domain containing -
Add to Cart The item has been addedHPA011635-100ULAnti-ST8SIA6 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen α-2,8-Sialyltransferase 8F recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA035800-100ULAnti-STAMBP antibody produced in rabbit (C15-1454-013)
Price: $928.29List Price: $1,031.43Immunogen STAM binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA035801-100ULAnti-STAMBP antibody produced in rabbit (C15-1454-014)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to STAM binding protein Sequence DCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA040202-100ULAnti-STAMBPL1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen STAM binding protein-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA068438-100ULANTI-STMN1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen stathmin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedCB1047-100UGAnti-STMN1 Rabbit pAb
Price: $794.88List Price: $883.20Purified rabbit polyclonal antibody. Recognizes the ~20 kDa STMN1 protein. -
Add to Cart The item has been addedAB5779Anti-Striatin Antibody (C15-1316-358)
Price: $759.43List Price: $843.81Striatin is found in all mammalian cells and may be involved in vesicular transport, dendrite growth and cellular signalling. It binds Protein phosphatase 2A (PP2A) A and C subunits and calmodulin and appears to modulate PP2A activity. -
Add to Cart The item has been addedHPA001204-25ULANTI-STX17
Price: $540.00List Price: $600.00Syntaxin 17 (Stx17) is an autophagosomal SNARE (soluble  N -ethylmaleimide-sensitive factor attachment protein receptor) protein. STX17 is a member of the syntaxin family and is located on human chromosome 9q31. -
Add to Cart The item has been addedHPA038189-100ULAnti-STX2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen syntaxin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA015564-100ULAnti-STXBP2 antibody produced in rabbit (C15-1448-367)
Price: $879.43List Price: $977.14Immunogen Syntaxin-binding protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA063868-100ULAnti-STXBP2 antibody produced in rabbit (C15-1464-501)
Price: $928.29List Price: $1,031.43Immunogen syntaxin binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
