-
Add to Cart The item has been addedCDS000136-250MG5-(DIBUTYLAMINO)-1-NAPHTHALENESULFONYL CHLORIDE
Price: $222.86List Price: $247.62Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product. -
Add to Cart The item has been added218898-1G5-(Dimethylamino)-1-naphthalenesulfonamide
Price: $309.43List Price: $343.81Application 5-(Dimethylamino)-1-naphthalenesulfonamide (DNSA) was used as starting reagent in the synthesis of 2,6-disubstituted pyridines, 6-substituted 2,2′-bipyridines and 6,6′-disubstituted 2,2′-bipyridines . It was also used -
Add to Cart The item has been addedHPA028748-25ULANTI-SLC12A3
Price: $540.00List Price: $600.00Immunogen solute carrier family 12 (sodium/chloride transporters), member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA057642-25Anti-SLC15A3 solute carrier family 15 (oligopeptide transpor (C08-0243-497)
Price: $718.81List Price: $798.67Anti-SLC15A3 solute carrier family 15 (oligopeptide transpor -
Add to Cart The item has been addedHPA057642-100Anti-SLC15A3 solute carrier family 15 (oligopeptide transpor (C08-0265-742)
Price: $957.50List Price: $1,063.89Anti-SLC15A3 solute carrier family 15 (oligopeptide transpor -
Add to Cart The item has been addedHPA063797-25ULANTI-SLC18A1
Price: $540.00List Price: $600.00SLC18A1 (solute carrier family 18 member A1) is also termed as vesicular monoamine transporter 1 (VMAT1). It is expressed in brain and in neurons of the peripheral nervous system, endocrine tissue and chromaffin cells. -
Add to Cart The item has been addedHPA029747-25Anti-SLC18B1 solute carrier family 18, subfamily B, member 1 (C08-0234-102)
Price: $718.81List Price: $798.67Anti-SLC18B1 solute carrier family 18, subfamily B, member 1 -
Add to Cart The item has been addedHPA029747-100Anti-SLC18B1 solute carrier family 18, subfamily B, member 1 (C08-0255-545)
Price: $957.50List Price: $1,063.89Anti-SLC18B1 solute carrier family 18, subfamily B, member 1 -
Add to Cart The item has been addedHPA035240-25ULANTI-SLC1A5
Price: $540.00List Price: $600.00Immunogen solute carrier family 1 (neutral amino acid transporter), member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedAV41640-100ULANTI-SLC22A1
Price: $759.43List Price: $843.81Solute carrier family 22 (organic cation transporter), member 1 (SLC22A1, 1-Oct, HOCT1, Oct1-cds) is a transporter of organic cations (OCT) that in addition to endogenous cations include various organic cationic toxins and drugs. Examples of drugs -
Add to Cart The item has been addedAV49670-100ULANTI-SLC22A23
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the middle region of human SLC22A23 Application Anti-SLC22A23 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
Add to Cart The item has been addedHPA074559-100ULAnti-SLC22A6
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to solute carrier family 22 member 6 Sequence PTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas
