Sulfanilamide or sulphanilamide

Immunogen Synthetic peptide directed towards the N terminal region of human SLC39A12 Application Anti-SLC39A12 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5&#956g/ml.

SLC3A2 (solute carrier family 3 member 2) is an integrin associated protein expressed at high levels on proliferating lymphocytes and other rapidly growing cells. It is also known as CD98hc and 4F2hc.

SLC45A4 (solute carrier family 45 member 4) belongs to the SLC45 family. It is strongly expressed in keratinocytes and HeLa cells.

The solute carrier family 5 member 2 (SLC5A2) gene, spanning 7.6kb with 14 exons, is mapped to human chromosome 16p11.

Immunogen Recombinant protein corresponding to SLC9A3 regulator 2 Sequence ETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

MF: C5H11NO4S MF: 181.20 CAS: 7314-32-1 Purity: >99% Titration

The LabChem sulfanilamide comes in a liquid form and works well with nitrogen. It is mainly used in laboratory and manufacturing factories. Application: For Laboratory and Manufacturing Use Only

The LabChem sulfanilamide comes in a liquid form and works well with nitrogen. It is mainly used in laboratory and manufacturing factories. Application: For Laboratory and Manufacturing Use Only

The LabChem 500 mL sulfanilamide/n-naphthyl reagent blends well with nitrogen is non-flammable in nature and is mainly used in laboratory and manufacturing factories. Application: For Laboratory and Manufacturing Use Only

The LabChem 1 Liter sulfanilamide/n-naphthyl reagent blends well with nitrogen is non-flammable in nature and is mainly used in laboratory and manufacturing factories. Application: For Laboratory and Manufacturing Use Only