Sulfathiazole zinc

(2-Naphthylmethyl)zinc bromide is an organozinc halide, which is typically used as a reagent in Negishi cross-coupling reactions. In this process, the organozinc halide reacts with organic halides or triflates to form a carbon-carbon bond in the

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

Legal Information Product of Rieke Metals, Inc. Rieke is a registered trademark of Rieke Metals, Inc.

2,3,7,8,12,13,17,18-Octaethyl-21 H ,23 H -porphine zinc(II) ) is formed by metalating 2,3,7,8,12,13,17,18-Octaethyl-21 H ,23 H -porphine with zinc.

Legal Information Product of Rieke Metals, Inc. Rieke is a registered trademark of Rieke Metals, Inc.

Zinc finger protein 593 (UniProt: O00488 also known as Zinc finger protein T86) is encoded by the ZNF593 (also known as ZT86) gene (Gene ID: 51042) in human. Zinc fingers are small protein domains wherein zinc plays a structural role contributing

Immunogen Recombinant protein corresponding to zinc finger matrin-type 3 Sequence GPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

For updated SDS information please visit www.goodfellow.

For updated SDS information please visit www.goodfellow.

For updated SDS information please visit www.goodfellow.

For updated SDS information please visit www.goodfellow.

For updated SDS information please visit www.goodfellow.