Sulfatolamide

Application ( R )-(-)- p -Toluenesulfinamide may be used in the preparation of E , E -( R )-(-)- N -(2,4-hexadienalidene)- p -toluenesulfinamide by reacting with sorbic aldehyde in the presence of titanium ethoxide.

Cell Line Origin Mouse Sp2/0 Ag-14 x Mouse BALB/c spleen Cell Line Description The antibody is directed against Shigella toxin and neutralises Shigella toxin activities from Shigella dysenteriae Type 1 and S. flexneri.

Application Useful reagent for introduction of a SES-protected nitrogen functionality, which can be cleaved with fluoride ion.

A synthetic amide of all- trans retinoic acid (RA) that displays reduced toxicity relative to RA while maintaining significant biological activity. Active in the prevention and treatment of a variety of neoplasms in animals.

A cell-permeable naphthoic acid compound that exhibits selective affinity and agonistic potency toward RAR&#946 and RAR&#947 over RAR&#945 (Kd = 34, 130, and 1100 nM, respectively AC 50 = 2.3, 9.

This phospho-Abi-1 antibody is validated for use in WB for the detection of the phospho-Abi-1 protein.

Immunogen Monocarboxylate transporter 8 recombinant protein epitope signature tag (PrEST) Application Anti-SLC16A2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody

SLC27A4 (solute carrier family 27 (fatty acid transporter), member 4) gene is localized to human chromosome 9q33.3-34.

Immunogen Recombinant protein corresponding to solute carrier family 6 member 2 Sequence MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

The organic anion transporting polypeptides (OATPS) are membrane bound transporters belonging to the SLC (solute carrier) superfamily. SLCO1B3 (solute carrier organic anion transporter family, member 1B3) or OATP1B3 is a drug transporter, which

Immunogen solute carrier organic anion transporter family, member 1B3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Synthetic peptide directed towards the N terminal region of human SLCO6A1 Application Anti-SLCO6A1 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0&#956g/ml.