Tiocarlide

Immunogen Recombinant protein corresponding to syndecan binding protein 2 Sequence VQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Synthetic peptide directed towards the C terminal region of human TAPBP Application Anti-TAPBP antibody produced in rabbit is suitable for western blotting at a concentration of 0.5&#956g/ml and for immunohistochemistry of

TIGAR (TP53-induced glycolysis and apoptosis regulator) is a p53-inducible protein that is thought to diminish levels of reactive oxygen species (ROS) and this may also contribute to p53 protecting from genomic damage. TIGAR&#8217s ability to

With over 100 years of experience in the development and manufacturing of clinical and industrial microbiological products under the BBL™ and Difco™ brands, BD Diagnostics is committed to providing you with the most highly responsive and technically

A cell-permeable synthetic peptide containing mouse TIRAP 138-151 fused to the Drosophila Antennapedia sequence. Specifically inhibits LPS-, but not CpG-induced NF-&#954B activation, PKR phosphorylation, and JNK phosphorylation in RAW.

TITRATION MODULE EA

Finding the right excipient that matches your needs as well as regulatory demands can be a complicated challenge. With our application know-how and regulatory expertise, we support you in every step of development, scale-up, and production.

Finding the right excipient that matches your needs as well as regulatory demands can be a complicated challenge. With our application know-how and regulatory expertise, we support you in every step of development, scale-up, and production.