Trimethoprim hydrochloride

Application 3,4,5-Trimethoxytoluene was used as a substructure model compound in the reaction of trimethoprim with free available chlorine (i.e.

Application 3,5,5-Trimethylhexanal was used in preparation of gem -dithiols via reaction with hydrogen sulfide.

Analysis Note Assay (GC, area%): &#8805 98.0 % (a/a) Density (d 20&#8199&#176C/ 4&#8199&#176C): 1.

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

Application 4,4&#8242,4&#8243-Trimethoxytrityl chloride can be used: In one of the key synthetic steps for the preparation of two phosphoramidite building blocks. To prepare protein tagging molecule

Application 4,4&#8242,4&#8243-Trimethoxytrityl chloride can be used: In one of the key synthetic steps for the preparation of two phosphoramidite building blocks. To prepare protein tagging molecule

4,4&#8242-Trimethylenedipyridine undergoes Willgerodt-Kindler reaction by on pot- polycondensation with dialdehydes in the presence of sulphur to form polythioamides . Application 4,4&#8242-Trimethylenedipiperidine was used in the synthesis of

Immunogen Recombinant protein corresponding to tripartite motif containing 46 Sequence LLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYW Application All Prestige Antibodies Powered by Atlas

BD ready-for-use prepared bottled media help detect microorganisms from pharmaceutical, food, environmental or water testing samples.

Application Formaldoxime trimer hydrochloride has been used in the synthesis of isoxazolidines .

Methyl trimethoxyacetate

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.