-
![[6]-gingerol, zingiber officinale - cas 23513-14-6 - calbiochem](https://cdn11.bigcommerce.com/s-2u2oi3cvy8/images/stencil/500x659/products/849039/676968/cenmed-product-image-placeholder-1-__23935.1717444971.jpg?c=1 "[6]-gingerol, zingiber officinale - cas 23513-14-6 - calbiochem")
Add to Cart The item has been added345868-5MG[6]-Gingerol, Zingiber officinale - CAS 23513-14-6 - Calbiochem
Price: $413.27List Price: $459.18An antitumor, apoptosis-inducing compound of the ginger family that blocks EGF-induced cell transformation by inhibiting the activation of Activator Protein-1 (AP-1). Also increases the Ca 2+ -ATPase activity in cardiac sarcoplasmic reticulum (EC -
Add to Cart The item has been addedHPA005789-25ULANTI-ZBTB17
Price: $540.00List Price: $600.00Immunogen Zinc finger and BTB domain-containing protein 17 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA076730-100ULAnti-ZBTB32
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger and BTB domain containing 32 Sequence CPSLASMQAHMRGHSPSQLPPGWTIRSTFLYSSSRPSRPSTSPCCPSSSTT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedAV39929-100ULANTI-ZBTB9
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ZBTB9 Biochem/physiol Actions ZBTB9 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. It may be involved in transcriptional regulation. -
Add to Cart The item has been addedHPA040140-25ULANTI-ZC3H13
Price: $540.00List Price: $600.00Immunogen zinc finger CCCH-type containing 13 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedAV50392-100ULANTI-ZMYND17
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the C terminal region of human ZMYND17 Application Anti-ZMyND17 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
Add to Cart The item has been addedAV50353-100ULANTI-ZNF121
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the middle region of human ZNF121 Application Anti-ZNF121 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
Add to Cart The item has been addedABE2917-100ULANTI-ZNF189 100 Y56 (C15-1317-112)
Price: $742.29List Price: $824.76Zinc finger protein 189 (UniProt: Q8BKP2 also known as ZNF189, ZFP189) is encoded by the Zfp189 gene (Gene ID: 230162) in murine species. ZFP189 is a highly conserved member of the Krüppel-associated box (KRAB)-containing group of zinc finger -
Add to Cart The item has been addedABE2917-25ULANTI-ZNF189 25 Y56 (C15-1317-113)
Price: $314.08List Price: $348.98Zinc finger protein 189 (UniProt: Q8BKP2 also known as ZNF189, ZFP189) is encoded by the Zfp189 gene (Gene ID: 230162) in murine species. ZFP189 is a highly conserved member of the Krüppel-associated box (KRAB)-containing group of zinc finger -
Add to Cart The item has been addedABE2922-100UGANTI-ZNF189 25 Y56 (C15-1317-114)
Price: $714.86List Price: $794.29Histone 1, H1e (UniProt: A3R0T8 also known as Histone H1.4, HIST1H1E) is encoded by the HIST1H1E (also known as hCG_16457421) gene (Gene ID: 3008) in human. -
Add to Cart The item has been addedABE2922-25UGANTI-ZNF189 25 Y56 (C15-1317-115)
Price: $304.90List Price: $338.78Histone 1, H1e (UniProt: A3R0T8 also known as Histone H1.4, HIST1H1E) is encoded by the HIST1H1E (also known as hCG_16457421) gene (Gene ID: 3008) in human. -
Add to Cart The item has been addedABE2927-100ULANTI-ZNF189 25 Y56 (C15-1317-116)
Price: $714.86List Price: $794.29Histone H3.3 (UniProt: P84243 also known as H3.
