-
Add to Cart The item has been addedF20408-25G2-Furanmethanethiol
Price: $129.69List Price: $144.102-Furanmethanethiol -
![3-(3 5-dioxo-2 3 4 5-tetrahydro-1 2 4-triazin-6-yl)-n'-[4-(trifluorome thyl)benzylidene]propanohydrazide](https://cdn11.bigcommerce.com/s-2u2oi3cvy8/images/stencil/500x659/products/853867/681796/cenmed-product-image-placeholder-1-__31182.1717446701.jpg?c=1 "3-(3 5-dioxo-2 3 4 5-tetrahydro-1 2 4-triazin-6-yl)-n'-[4-(trifluorome thyl)benzylidene]propanohydrazide")
Add to Cart The item has been addedL149152-1EA3-(3 5-DIOXO-2 3 4 5-TETRAHYDRO-1 2 4-TRIAZIN-6-YL)-N'-[4-(TRIFLUOROME THYL)BENZYLIDENE]PROPANOHYDRAZIDE
Price: $69.66List Price: $77.40Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of rare and unique chemicals. Sigma-Aldrich does not collect analytical data for this product. -
![3-[(3 5-dioxo-2 3 4 5-tetrahydro-1 2 4-triazin-6-yl)amino]-n'-[4-(trif luoromethyl)benzylidene]propanohydrazide](https://cdn11.bigcommerce.com/s-2u2oi3cvy8/images/stencil/500x659/products/853863/681792/cenmed-product-image-placeholder-1-__35097.1717446700.jpg?c=1 "3-[(3 5-dioxo-2 3 4 5-tetrahydro-1 2 4-triazin-6-yl)amino]-n'-[4-(trif luoromethyl)benzylidene]propanohydrazide")
Add to Cart The item has been addedL149470-1EA3-[(3 5-DIOXO-2 3 4 5-TETRAHYDRO-1 2 4-TRIAZIN-6-YL)AMINO]-N'-[4-(TRIF LUOROMETHYL)BENZYLIDENE]PROPANOHYDRAZIDE
Price: $69.66List Price: $77.40Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of rare and unique chemicals. Sigma-Aldrich does not collect analytical data for this product. -
Add to Cart The item has been addedHPA068695-100ULAnti-FTO
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to FTO, alpha-ketoglutarate dependent dioxygenase Sequence LFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAA Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedABS2200-100ULAnti-FtsZ (GTPase) (C15-1317-828)
Price: $759.43List Price: $843.81Cell division protein FtsZ (UniProt: P17865 also known as Cell Division FtsZ GTPase, FtsZ) is encoded by the FtsZ (also known as BSU15290) gene (Gene ID: 935971) in Bacillus subtilis. FtsZ is homodimeric prokaryotic homologue of tubulin with -
Add to Cart The item has been addedABS2200-25ULAnti-FtsZ (GTPase) (C15-1317-829)
Price: $323.27List Price: $359.18Cell division protein FtsZ (UniProt: P17865 also known as Cell Division FtsZ GTPase, FtsZ) is encoded by the FtsZ (also known as BSU15290) gene (Gene ID: 935971) in Bacillus subtilis. FtsZ is homodimeric prokaryotic homologue of tubulin with -
-
-
Add to Cart The item has been addedA0SE5935-5ZFMOC-GLU(OBZL)-2-CLTRT RSN 5GR
Price: $497.03List Price: $552.26Structure confirmed. Will ship with Certificate of Analysis (CoA) -
Add to Cart The item has been addedA0FY2560-5ZFMOC-TYR(BZL)-OH, 5GR
Price: $115.97List Price: $128.85Structure confirmed. Purity = 98%. Will ship with Certificate of Analysis (CoA) -
Add to Cart The item has been added04399-91Cole-Parmer Essentials
FRZR RCK UP 96/384PLT 112MAX (C22-1488-835)
Price: $329.80List Price: $366.45FRZR RCK UP 96/384PLT 112MAX -
Add to Cart The item has been added04400-07Cole-Parmer Essentials
FRZR RCK UP 96/384PLT 112MAX (C22-1488-841)
Price: $345.82List Price: $384.24FRZR RCK UP 96/384PLT 112MAX
