Antifungal drugs

GRN (granulin) is a large cysteine rich glycoprotein, also called progranulin, which has a molecular weight of 88,000kDa. It is the largest member of granulin/epithelin family of growth factors.

Immunogen KIT ligand Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

The gene NYNRIN (NYN domain and retroviral integrase catalytic domain-containing protein) is mapped to human chromosome 14q11.2.

Immunogen protein kinase N2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Ras association domain-containing protein 1 (UniProt: Q9NS23 RASSF1) is encoded by the RASSF1 (also known as RDA32) gene (Gene ID: 11186) in human. RASSF1 serves as a potential tumor suppressor and is shown to be essential for death

Ras association domain-containing protein 1 (UniProt: Q9NS23 RASSF1) is encoded by the RASSF1 (also known as RDA32) gene (Gene ID: 11186) in human. RASSF1 serves as a potential tumor suppressor and is shown to be essential for death

Immunogen Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Recombinant protein corresponding to refilin A Sequence MLPVFFGESIKVNPEPTHEIRCNSEVKYASEKHFQDKVFYAPVPTVTAYSETIVAAPNCTWRNY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Zinc finger protein with KRAB and SCAN domains 3 (UniProt: Q9BRR0 also known as Zinc finger and SCAN domain-containing protein 13, Zinc finger protein 306, Zinc finger protein 309, Zinc finger protein 47 homolog, Zf47, Zfp-47) is encoded by the

Zinc finger protein with KRAB and SCAN domains 3 (UniProt: Q9BRR0 also known as Zinc finger and SCAN domain-containing protein 13, Zinc finger protein 306, Zinc finger protein 309, Zinc finger protein 47 homolog, Zf47, Zfp-47) is encoded by the

ZNF655 codes for a nuclear zinc finger protein that negatively modulates G1/S transition during mitosis. Rabbit Anti-ZNF655 antibody recognizes bovine, rat, canine, and human ZNF655.

Legal Information CERILLIANT is a registered trademark of Cerilliant Corporation Snap-N-Shoot is a registered trademark of Cerilliant Corporation Snap-N-Spike is a registered trademark of Cerilliant Corporation