-
Add to Cart The item has been addedHPA075379-100ULImmunogen Recombinant protein corresponding to desmocollin 1 Sequence RQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQSQDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTG Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA075379-25ULImmunogen Recombinant protein corresponding to desmocollin 1 Sequence RQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQSQDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTG Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA005835-25ULImmunogen Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedHPA027241-100ULSigma-Aldrich
Anti-ECM1 antibody produced in rabbit (C15-1451-382)
Price: $879.43List Price: $977.14Extracellular matrix protein 1 (ECM1) is a glycoprotein. It is expressed in skin and other tissues. -
Add to Cart The item has been addedHPA076029-100ULSigma-Aldrich
ANTI-ECM1 ANTIBODY PRODUCED IN RABBIT (C15-1466-818)
Price: $977.14List Price: $1,085.71Immunogen extracellular matrix protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA067188-100ULImmunogen ephrin-B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA066751-25ULImmunogen EH-domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA060022-25ULImmunogen euchromatic histone-lysine N-methyltransferase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been added53509Anti-EHMT1; ; 100 æg
Price: $1,092.50List Price: $1,213.89Use Anti-EHMT1 Antibody (Rabbit Polyclonal Antibody) validated in ICC, ELISA, WB to detect EHMT1 also known as H3-K9-HMTase 5, Histone H3-K9 methyltransferase 5. -
Add to Cart The item has been addedHPA002561-100ULImmunogen eukaryotic translation initiation factor 1A, X-linked Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA044256-25ULImmunogen epididymal sperm binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedDR1061-100UGAnti-ENO1, mouse monoclonal, clone 8G8, recognizes the ~45-48 kDa ENO1 in MCF-7 and HeLa cells and in human lymphoma tissue. It is validated for use in ELISA, WB, ICC, & IHC (paraffin sections).
