Antihistamines or H1 blockers

Immunogen Ectonucleoside triphosphate diphosphohydrolase 1 recombinant protein epitope signature tag (PrEST) Application Anti-ENTPD1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA)

Immunogen Histone acetyltransferase p300 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Exchange protein directly activated by cAMP 1 (EPAC1) is also known as Rap guanine nuclear exchange factor 3 and cAMPGEF-I. EPAC1 is a guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases which are activated through cAMP

Immunogen endothelial PAS domain protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to endothelial PAS domain protein 1 Sequence EDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPP Application All Prestige Antibodies Powered by Atlas Antibodies are

Anti-EPHA4, mouse monoclonal, clone 6H7, recognizes the EPHA4 protein in NIH3T3 cells. It is validated for use in ELISA and Western blotting.

Immunogen Estrogen receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Anti-Factor H, goat polyclonal, recognizes Factor H in human. It is validated for Radial Immunodiffusion and Ouchterlony.

Immunogen Synthetic peptide directed towards the middle region of human FEM1B Application Anti-FEM1B (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/mL. Biochem/physiol Actions FEM1B [fem-1 homolog

Immunogen fermitin family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen forkhead-associated (FHA) phosphopeptide binding domain 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen FH1/FH2 domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,