Antihistamines or H1 blockers

Immunogen lymphatic vessel endothelial hyaluronan receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen leucine-zipper-like transcription regulator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Leucine zipper, putative tumor suppressor 1 (LZTS1) is a protein that regulates the molecular events involved in progression of cells through the M phase of mitosis. It functions as a tumor suppressor for a range of major cancer histotypes, such as

Metastasis-associated in colon cancer protein 1, also known as SH3 domain-containing protein 7a5, and encoded by the gene name MACC1, is a key regulator of the hepatocyte growth factor (HGF)-HGF receptor (MET) pathway. This pathway is involved in

Microtubule-associated protein 2 (UniProt: P15146 also known as MAP-2) is encoded by the Map2 (also known as Mtap2) gene (Gene ID: 25595) in Rat. MAPs are a family of proteins that bind to and stabilize microtubules.

MAP1B (Microtubule-associated protein 1B) is an integral plasma membrane glycoprotein expressed in vesicles and the plasma membrane of neurons. It consists of KKEE and KKEVI motifs with microtubule binding capacity.

Immunogen microtubule-associated protein 1S recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to microtubule associated serine/threonine kinase 1 Sequence LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Homeobox protein Meis1 (UniProt: Q60954-1 also known as Myeloid ecotropic viral integration site 1) Homeobox protein Meis2 (UniProt: P97367-2 also known as Meis1-related protein 1) are encoded by the Meis1 and Meis2 (also known as Mrg1, Stra10)

Immunogen mesenchyme homeobox 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Glutamine methylation occurs on translation termination factors and ribosomal proteins. Protein methylation has been reported to affect various cellular processes including protein stability, protein-protein interaction, and protein localization.

Glutamine methylation occurs on translation termination factors and ribosomal proteins. Protein methylation has been reported to affect various cellular processes including protein stability, protein-protein interaction, and protein localization.