-
Add to Cart The item has been addedABN1680Pannexin-1 (UniProt: P60570) is encoded by the Panx1 (also known as Px1) gene (Gene ID: 315435) in rat. Pannexin-1 is a multi-pass membrane protein of the pannexin family that serves as a high-conductance, voltage-gated channel. -
Add to Cart The item has been addedHPA012115-25ULImmunogen Phytanoyl-CoA dioxygenase domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA012115-100ULImmunogen Phytanoyl-CoA dioxygenase domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA072496-100ULImmunogen Recombinant protein corresponding to PIH1 domain containing 3 Sequence MDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA003982-25ULImmunogen Serine/threonine-protein kinase N1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA004128-25ULProteolipid protein 1 (PLP1) gene encodes for two major proteins of the central nervous system (CNS) myelin, such as proteolipid protein (PLP) and DM20. This gene is located on the human chromosome at Xq22. -
Add to Cart The item has been addedAB3517Specificity Polyhistidine tag, 6-His Tag containing proteins Immunogen Synthetic peptide consisting of six histidines. Application Anti-Polyhistidine Tag Antibody detects level of Polyhistidine Tag & has been published & validated for use -
Add to Cart The item has been added801095Anti-PON1 Clone KRJ1 (1 mg)
Price: $3,040.62List Price: $3,378.47PON1 (arylesterase/paraoxonase) is a polymorphic enzyme closely associated with high-density lipoproteins (HDL). -
Add to Cart The item has been added801097Anti-PON1 Clone KRJ2 (1 mg)
Price: $613.89List Price: $682.10PON1 (arylesterase/paraoxonase) is a polymorphic enzyme closely associated with high-density lipoproteins (HDL). -
Add to Cart The item has been addedHPA077492-100ULImmunogen Recombinant protein corresponding to protein phosphatase 1 regulatory subunit 36 Sequence LMALLYYLSHYLEKNSLEKKPKSYMVGLVEKKEMELVLSELEAAQRYLAQKYCILVLGLAVPDKHHMCCGKEKISDTQK Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA027726-25ULImmunogen Neurabin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA031053-100ULImmunogen prominin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
