Antihistamines or H1 blockers

Immunogen Tyrosine-protein phosphatase non-receptor type 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Retinal dehydrogenase 2 (EC 1.2.

Aldehyde dehydrogenase family 1 member A3 (EC 1.2.

Ran GTPase-activating protein (UniProt: Q9VIW3 also known as RanGAP, Protein segregation distorter) is encoded by the RanGAP (also known as Sd, CG9999) gene (Gene ID: 35223) in Drosophila melanogaster. Ran is a small GTPase located predominantly

Ran GTPase-activating protein (UniProt: Q9VIW3 also known as RanGAP, Protein segregation distorter) is encoded by the RanGAP (also known as Sd, CG9999) gene (Gene ID: 35223) in Drosophila melanogaster. Ran is a small GTPase located predominantly

RNA binding motif protein, &#947-linked, family 1, member A1 (RBMy1A1, &#947RRM1, &#947RRM2) is a germ-cell specific nuclear RNA-binding protein involves in spermatogenesis. RBM&#947 binds to RNA stem-loops capped by a C(A)/(U)CAA pentaloops

Immunogen reticulocalbin 1, EF-hand calcium binding domain recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Recombinant protein corresponding to RAD52 motif containing 1 Sequence AELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

ATP-dependent DNA helicase Q1 (UniProt: P46063 also known as EC:3.6.

Immunoaffinity purified goat polyclonal antibody. Recognizes the ~140 kDa RENT1 protein.

RHOT1 is a protein found mainly in mitochondria. It has a pivotal role in mitochondrial homeostasis and apoptosis.

Rabbit Anti-RUVBL1 antibody recognizes zebrafish, human, mouse, rat, chicken, canine, and bovine RUVBL1. Immunogen Synthetic peptide directed towards the N terminal region of human RUVBL1 Application Rabbit Anti-RUVBL1 antibody can be used for