Antihistamines or H1 blockers

Signal-induced proliferation associated-like protein 1 (SIPA1L1), also called High-risk human papilloma viruses E6 oncoproteins targeted protein 1 (E6-targeted protein 1) is widely expressed and bound at the carboxy-terminus by Casein kinase I

Immunogen NAD-dependent deacetylase sirtuin-1 recombinant protein epitope signature tag (PrEST) Application Anti-SIRT1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each

Zinc finger protein SNAI2 (UniProt: O43623 also known as Neural crest transcription factor Slug, SLUG, Protein snail homolog 2) is encoded by the SNAI2 (also known as SLUG, SLUGH) gene (Gene ID: 6591) in human. SLUG is a transcriptional repressor

Immunogen SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Sperm adhesion molecule 1 (SPAM1) belongs to the hyaluronidase family and the gene encoding it is localized on human chromosome 7q31. Immunogen Hyaluronidase PH-20 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige

Sterol regulatory element-binding protein 1 (UniProt: P36956 also known as SREBP-1, Class D basic helix-loop-helix protein 1, bHLHd1, Sterol regulatory element-binding transcription factor 1) is encoded by the SREBF1 (also known as BHLHD1, SREBP1)

Sterol regulatory element-binding protein 1 (UniProt: P36956 also known as SREBP-1, Class D basic helix-loop-helix protein 1, bHLHd1, Sterol regulatory element-binding transcription factor 1) is encoded by the SREBF1 (also known as BHLHD1, SREBP1)

Immunogen T cell-interacting, activating receptor on myeloid cells 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen T cell-interacting, activating receptor on myeloid cells 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen TBC1 domain family member 15 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to T-box, brain 1 Sequence LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen Recombinant protein corresponding to T-box, brain 1 Sequence LLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the