Antihistamines or H1 blockers

Immunogen Recombinant protein corresponding to talin 2 Sequence IEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQALHDLLQHVRQFASRG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Synthetic peptide directed towards the middle region of human TMED4 Biochem/physiol Actions TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. Sequence Synthetic peptide located within the following region:

TMEM30A (transmembrane protein 30A) is a functional homolog of Saccharomyces cerevisiae Lem3p protein. It has the conserved sequence QNHRRYVKS and is a transmembrane protein.

Immunogen transmembrane protein 8C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to transmembrane protease, serine 15 Sequence LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK Application All Prestige Antibodies Powered by Atlas Antibodies are

DNA topoisomerase 2-binding protein 1 (UniProt Q92547 also known as DNA topoisomerase II-beta-binding protein 1, DNA topoisomerase II-binding protein 1, TopBP1) is encoded by the TOPBP1 (also known as KIAA0259) gene (Gene ID 11073) in human.

Immunogen topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Synthetic peptide directed towards the C terminal region of human TOR1B Application Anti-TOR1B antibody produced in rabbit is suitable for western blotting at a concentration of 0.5&#956g/mL.

Heat shock protein 75 kDa, mitochondrial (UniProt: Q12931 also known as HSP 75, TNFR-associated protein 1, Tumor necrosis factor type 1 receptor-associated protein, TRAP-1) is encoded by the Trap1 (also known as Hsp75) gene (Gene ID: 287069) in

Histone H3 is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template.

Histone H3 is a core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template.

Histones are highly conserved proteins that serve as the structural scaffold for the organization of nuclear DNA into chromatin. The four core histones, H2A, H2B, H3, and H4, assemble into an octamer (2 molecules of each).