Antihistamines or H1 blockers

Histones are highly conserved proteins that serve as the structural scaffold for the organization of nuclear DNA into chromatin. The four core histones, H2A, H2B, H3, and H4, assemble into an octamer (2 molecules of each).

Histones are nuclear proteins that form octameric structures which bind DNA to form units of chromatin called nucleosomes. The family of histones&#8212H2A, H2B, H3, and H4&#8212are key players in gene regulation.

Histones are nuclear proteins that form octameric structures which bind DNA to form units of chromatin called nucleosomes. The family of histones&#8212H2A, H2B, H3, and H4&#8212are key players in gene regulation.

Immunogen Recombinant protein corresponding to transcriptional repressor GATA binding 1 Sequence IRRRTRKRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTLDIHKRM Application All Prestige Antibodies Powered by Atlas

Twinfilin actin binding protein 1 (TWF1) belongs to the actin depolymerizing factor homology (ADF-H) family. It is expressed in non-muscle tissues.

UBQLN2 (ubiquilin 2) is one of the four ubiquilin proteins found in humans, which contains a ubiquitin-like domain in its N-terminal, and a ubiquitin-associated domain in its C-terminal. The central region of this protein consists of four different

Purified mouse monoclonal antibody. Recognizes the ~90 kDa UHRF1 protein.

Vesicular glutamate transporter 1 (VGLUT1) is encoded by the gene mapped to human chromosome 19q13. VGLUT1 is specifically expressed in neuronal cells in the brain.

Specificity Vesicular Monoamine Transporter 1 (VMAT1). An antibody made to the C-terminal VMAT1 peptide detected a major band at ~55 kDa in postnuclear supernatants of CHO transfected with VMAT1 and not in wild type cells (Liu et al.

Specificity Recognizes Vesicular Monoamine Transporter 2 (VMAT2). An antibody made to the C-terminal VMAT2 peptide detected a major band at ~55 kDa in postnuclear supernatants of CHO transfected with VMAT2 and not in wild type cells (Peter et al.

WASH complex subunit 1 (WASHC1) is located on human chromosome 9p24.3.

WWTR1 belongs to WW domain with a transcription coactivator that regulates development of multiple organs and mesenchymal differentiation. It is a significant target of Hippo pathway for controlling cell proliferation tumourigenesis.