Antihistamines or H1 blockers

Immunogen Recombinant protein corresponding to adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1. Sequence KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR Application All

Aquaporin 1 is an integral membrane protein which was originally identified in red blood cells and renal proximal tubules. AQP1 is also expressed by the choroid plexus and various other tissues.

FUNCTION: SwissProt: P29972 # Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Immunogen Rho GTPase activating protein 21 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Rho GTPase activating protein 21 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Rho GTPase activating protein 25 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Rho GTPase activating protein 27 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Rho GTPase-activating protein 29 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Rho guanine nucleotide exchange factor 1 (ARHGEF1) is a member of a family of Rho-specific guanine nucleotide exchange factors. It contains a regulator of G protein signaling (rgRGS) domain near its amino-terminus.

Immunogen Rho guanine nucleotide exchange factor (GEF) 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Rho guanine nucleotide exchange factor 6 (UniProt Q15052 also known as Alpha-Pix, COOL-2, PAK-interacting exchange factor alpha, Rac/Cdc42 guanine nucleotide exchange factor 6) is encoded by the ARHGEF6 (also known as COOL2, KIAA0006, MRX46, PIXA)

The Arp2/3 complex is composed of seven subunits, such as Arp2, Arp3, p41-Arc, p34-Arc, p21-Arc, p20-Arc, and p16-Arc (p complex). Among all the subunits, ARPC1B is a novel member of the Sop2 family of WD (tryptophan and aspartate)