-
Add to Cart The item has been addedHPA042109-25ULImmunogen arrestin domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAP1138-50UGAnti-ARSA, mouse polyclonal, recognizes the ~55 kDa ARSA protein in human lymph node tissue. It is validated for Western blotting and paraffin sections. -
Add to Cart The item has been addedABN468N-acylsphingosine amidohydrolase (Acid ceramidase) 1, or ASAH1 is part of a family of hydrolyases, localized in the lysosome, that catalyze the degradation of ceramide into sphingosine (SPH) and free fatty acid. Ceraminde is a subgroup of -
Add to Cart The item has been addedHPA030502-25ULImmunogen anti-silencing function 1A histone chaperone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedABE204Ash1L, also known as Histone-lysine N-methyltransferase ASH1L, or ASH1-like protein (huASH1), Absent small and homeotic disks protein 1 homolog, or Lysine N-methyltransferase 2H, and encoded by the gene ASH1L/KIAA1420/KMT2H, is a histone -
Add to Cart The item has been addedABE1972Set1/Ash2 histone methyltransferase complex subunit ASH2 (UniProt Q9UBL3 & Q91X20 also known as ASH2-like protein) is encoded by the human ASH2L (also known as ASH2L1) and murine Ash2l gene (Gene ID 9070 & 23808). Ash2L is a component of -
Add to Cart The item has been addedHPA038444-25ULImmunogen arginyltransferase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedAB2204Brain and muscle Arnt-like protein-1 (BMAL1 also known as MOP3 or Arnt3) is a transcription factor known to regulate circadian rhythm. BMAL1 is the only component of the mammalian circadian clock whose sole deletion in a mouse model generates -
Add to Cart The item has been addedAB9415Sigma-Aldrich
Anti-Cannabinoid Receptor 1 Antibody (C15-1316-508)
Price: $1,011.43List Price: $1,123.81Specificity Recognizes Cannabinoid Receptor 1 [CB1]. Immunogen Synthetic peptide from the 3rd cytoplasmic domain of human Cannabinoid Receptor 1. -
Add to Cart The item has been addedHPA076768-100ULImmunogen Recombinant protein corresponding to calpain small subunit 2 Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been added105739Anti-CAPZIP; 100 æL
Price: $863.74List Price: $959.71Anti-CAPZIP detects levels of CAPZIP proteins & has been published & validated for use in WB & IP. -
Add to Cart The item has been addedHPA053573-25ULImmunogen caspase 8 associated protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
