Antihistamines or H1 blockers

Immunogen Synthetic peptide directed towards the C terminal region of human CREB3 Biochem/physiol Actions CREB3 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the

CREB3L1 (OASIS) is a transcription factor that is involved in the regulation of endoplasmic reticulum (ER) stress. It activates extracellular matrix gene expression and may play a role in the development of pancreas .

Immunogen cAMP responsive element binding protein 3-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to cysteine rich secretory protein 1 Sequence TSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen dullard homolog ( Xenopus laevis ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Specificity Reacts with rat cytochrome P450 enzyme CYP1A1 and CYP1A2 on Western blots of hepatic microsomal fractions. No cross-reactivity with other cytochrome P450 enzymes.

Specificity Reacts with human cytochrome P450 CYP1A1 in human placental microsomal fraction and to recombinant human CYP1A1. Immunogen Synthetic peptide Application Anti-Cytochrome P450 Enzyme CYP1A1 Antibody detects level of Cytochrome P450 Enzyme

Specificity Reacts with human cytochrome P450 enzyme CYP1A2 in hepatic microsomal fraction. No cross-reactivity with other cytochrome P450 enzymes.

Specificity Reacts with rat cytochrome P450 enzyme CYP3A1 in hepatic microsomal fraction. No cross-reactivity with other cytochrome P450 enzymes including CYP3A2.

Immunogen cysteine/tyrosine-rich 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Dachshund homolog 1 (DACH1) contains a DS domain essential for its function. The gene encoding it is located on chromosome 13q21.

DAXX (death-domain associated protein) is a nuclear protein, which is highly conserved in nature. It shuttles between nucleus and cytoplasm.