Antihistamines or H1 blockers

Immunogen Synthetic peptide directed towards the C terminal region of human DCST1 Sequence Synthetic peptide located within the following region: SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG Physical form Purified antibody supplied in 1x PBS

Specificity Desmin. Reacts specifically with desmin in cultured cells or tissue preparations originating from chicken, human, bovine and mouse tissue.

DPYD is an important enzyme involved in pyrimidine base degradation and catabolism. DPYD catalyzes the reduction of uracil and thymine and also is a critical enzyme in the degradation of the chemotherapeutic drug 5-fluoruracil.

Histone H2B is one of four histones that form a core octameric structure required for the packaging of DNA into nucleosomes, the most basic level of chromatin arrangement. Histones undergo a number of post-translational modifications (PTM) at their

Histones are highly conserved proteins that serve as the structural scaffold for the organization of nuclear DNA into chromatin. The four core histones, H2A, H2B, H3, and H4, assemble into an octamer (2 molecules of each).

Histone H3 is one of the five main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H3 is involved with the structure of the nucleosomes of the &#8242beads on

Histone H3 is one of the five main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H3 is involved with the structure of the nucleosomes of the &#8242beads on

Immunogen DIM1 dimethyladenosine transferase 1 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Application anti -Diphenylglyoxime (&#945-Benzil dioxime) was used as a chelating agent in differential pulse adsorptive stripping voltammetric (DPASV) determination of cobalt in vegetable animal foodstuffs .

Immunogen Recombinant protein corresponding to disrupted in renal carcinoma 1 Sequence EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Specificity Recognizes Dopamine beta hydroxylase. AB1585 reacts with a single band on Western blots of bovine adrenal homogenates and stains only cells known to contain DBH, such as sympathetic neurons, adrenal medullary cells and central

Plasmalemmal neurotransmitter transporters sequester synaptic and peri synaptic transmitter into presynaptic elements. The Dopamine Transporter (DAT) is responsible for the reaccumulation of dopamine after it has been released.