Alcaftadine

Acetone is a commonly used material in the manufacture of various chemicals like methyl isobutyl ketone, mesityl oxide, diacetone alcohol, acetic acid (via the ketene process), iodoform, and bromoform. Other products where acetone is utilized in

The LabChem ACS acetone in liquid form, is soluble in water, ethanol, ether, dimethyl ether, petroleum spirit, chloroform, dimethylformamide and oils/fats. It is non-flammable and has aromatic/sweet/fruity odor.

1 bottle 100 Tablets

Immunogen Retinal dehydrogenase 1 recombinant protein epitope signature tag (PrEST) Application Anti-ALDH1A1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

Immunogen aldehyde dehydrogenase 1 family, member A3 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.

Immunogen Synthetic peptide directed towards the middle region of human ALDH1L1 Biochem/physiol Actions ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs

Immunogen aldehyde dehydrogenase 1 family, member L1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen aldehyde dehydrogenase 1 family, member L1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen arachidonate 15-lipoxygenase, type B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1. Sequence KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR Application All

Immunogen endothelial PAS domain protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to endothelial PAS domain protein 1 Sequence EDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPP Application All Prestige Antibodies Powered by Atlas Antibodies are