-
Add to Cart The item has been added146358-100G1-Ethyl-2-pyrrolidone (C15-1227-172)
Price: $268.71List Price: $298.571-Ethyl-2-pyrrolidone is a transdermal absorption-enhancing compound and mechanism of its effect on multilammellar liposome of stratum corneum lipid has been studied . Application 1-Ethyl-2-pyrrolidone was used to modify coir fiber (from Cocos -
Add to Cart The item has been added146358-500G1-Ethyl-2-pyrrolidone (C15-1227-173)
Price: $741.00List Price: $823.331-Ethyl-2-pyrrolidone is a transdermal absorption-enhancing compound and mechanism of its effect on multilammellar liposome of stratum corneum lipid has been studied . Application 1-Ethyl-2-pyrrolidone was used to modify coir fiber (from Cocos -
Add to Cart The item has been addedHPA077492-100ULAnti-PPP1R36
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to protein phosphatase 1 regulatory subunit 36 Sequence LMALLYYLSHYLEKNSLEKKPKSYMVGLVEKKEMELVLSELEAAQRYLAQKYCILVLGLAVPDKHHMCCGKEKISDTQK Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA012542-25ULANTI-PTPN1
Price: $540.00List Price: $600.00Immunogen Tyrosine-protein phosphatase non-receptor type 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
-
