Bamipine salicylate

N-acylsphingosine amidohydrolase (Acid ceramidase) 1, or ASAH1 is part of a family of hydrolyases, localized in the lysosome, that catalyze the degradation of ceramide into sphingosine (SPH) and free fatty acid. Ceraminde is a subgroup of

Immunogen Recombinant protein corresponding to cysteine rich secretory protein 1 Sequence TSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen Sal-like protein 3 recombinant protein epitope signature tag (PrEST) Application Anti-SALL3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by

Purified mouse monoclonal antibody. Recognizes the ~100 kDa SALL4 protein.

Purchase the proper bushing to connect any Small Hub Removable Needle (RN) or a Hat Needle to a 1/4-28 flat bottom port.

Peptone from soymeal is a widely used, non-animal peptone used in industrial microbiology as a nutrient source for the growth of microorganisms in large-scale fermentation processes. Peptone from soymeal, also known as soy peptone or peptic soy

PrEST Antigen ARID1B AT rich interactive domain 1B (SWI1-lik

PrEST Antigen ARID1B AT rich interactive domain 1B (SWI1-lik

PrEST Antigen BAIAP2L2 BAI1-associated protein 2-like 2, 100

PrEST Antigen SALL1 spalt like transcription factor 1, 100ul

PrEST Antigen SALL1 spalt-like transcription factor 1, 100ul

PrEST Antigen SAMD12 sterile alpha motif domain containing 1