Clocinizine

Immunogen Recombinant protein corresponding to calpain small subunit 2 Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen chromatin modifying protein 2A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen chromatin modifying protein 2A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Charged multivesicular body protein 4c recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Claudin-1 (CLDN1), also called senescence-associated epithelial membrane protein (SEMP1), is a component of tight junctions strands. It is 22 kDa protein and has four transmembrane strands.

Purified mouse monoclonal antibody. Recognizes the ~17 kDa CLDN1 protein.

LIM domain-binding protein 1 (UniProt P70662 CLIM-2, LDB-1) encoded by the murine Ldb2 gene (Clim2, Nli Gene ID 16825) and LIM domain-binding protein 2 (UniProt O55203 CLIM-1, LDB-2, CLP-36) encoded by the murine Ldb2 gene (Clim1 Gene ID 16826)

Immunogen chloride channel, nucleotide-sensitive, 1A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen chloride channel, nucleotide-sensitive, 1A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Chloride nucleotide-sensitive channel 1A (CLNS1A), also called ICLN, is a 25 kDa channel protein with nucleotide and calcium binding regions. The CLNS1A gene is located on human chromosome 11q14.

Immunogen Calsyntenin-1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen calsyntenin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The