-
Add to Cart The item has been addedHPA012672-25ULANTI-DACH1
Price: $540.00List Price: $600.00Dachshund homolog 1 (DACH1) contains a DS domain essential for its function. The gene encoding it is located on chromosome 13q21. -
Add to Cart The item has been addedAV43421-100ULANTI-DCST1
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the C terminal region of human DCST1 Sequence Synthetic peptide located within the following region: SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedHPA075379-100ULAnti-DSC1 (C15-1466-722)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to desmocollin 1 Sequence RQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQSQDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTG Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA075379-25ULANTI-DSC1 (C15-1466-723)
Price: $540.00List Price: $600.00Immunogen Recombinant protein corresponding to desmocollin 1 Sequence RQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQSQDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTG Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedAB5714Anti-Hey 1/HRT1 Antibody (C15-1316-335)
Price: $804.00List Price: $893.33Specificity Recognizes Hey 1 / HRT1, a Helix-loop-helix class of transcription factor. Immunogen Synthetic peptide, amino acids 207-220 of human Hey 1 / HRT1. -
Add to Cart The item has been addedAB5716Anti-Hey 2/HRT2 Antibody (C15-1316-336)
Price: $804.00List Price: $893.33Specificity Recognizes Hey 2 / HRT2, a Helix-loop-helix class of transcription factor. Immunogen Synthetic peptide, amino acids 314-330 of human Hey 2 / HRT2. -
Add to Cart The item has been addedHPA003916-25ULANTI-SMARCE1
Price: $540.00List Price: $600.00Immunogen SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedH9538-2MGHNE-DMA (C15-1444-675)
Price: $248.57List Price: $276.19Biochem/physiol Actions Stable form of HNE toxic second messenger of free radicals. Preparation Note To prepare HNE from HNE-DMA: evaporate the hexane under a gentle stream of nitrogen at room temperature. -
Add to Cart The item has been addedH9538-5MGHNE-DMA (C15-1444-676)
Price: $427.96List Price: $475.51Biochem/physiol Actions Stable form of HNE toxic second messenger of free radicals. Preparation Note To prepare HNE from HNE-DMA: evaporate the hexane under a gentle stream of nitrogen at room temperature. -
Add to Cart The item has been added30683706OHAUS DefenderT 3000 Washdown Bases D150C1X
Price: $2,581.82List Price: $2,868.69The Defender 3000 Stainless Steel Bases offer economical yet durable performance for industrial weighing in washdown environments. With NTEP certification, Measurement Canada and OIML approval, these bases can be used for both general applications -
Add to Cart The item has been added30683697OHAUS DefenderT 3000 Washdown Bases D15C1R
Price: $1,092.26List Price: $1,213.62The Defender 3000 Stainless Steel Bases offer economical yet durable performance for industrial weighing in washdown environments. With NTEP certification, Measurement Canada and OIML approval, these bases can be used for both general applications -
Add to Cart The item has been added30683707OHAUS DefenderT 3000 Washdown Bases D300C1X
Price: $2,581.82List Price: $2,868.69The Defender 3000 Stainless Steel Bases offer economical yet durable performance for industrial weighing in washdown environments. With NTEP certification, Measurement Canada and OIML approval, these bases can be used for both general applications
