Eflumast

E3 ubiquitin-protein ligase synoviolin (UniProt Q86TM6 also known as Synovial apoptosis inhibitor 1) is encoded by the SYVN1 (also known as HRD1, KIAA1810) gene (Gene ID 84447) in human. E3 ubiquitin-protein ligase synoviolin is a

Purified mouse monoclonal antibody generated by immunizing mice with the specified immunogen and fusing Balb/c splenocytes with p3-NS-1/Ag4-1 (NS1) mouse myeloma cells (see application references). Recognizes the ~85-115 kDa ICAM-1 protein.

Inositol-requiring protein 1 (IRE1p), also known as Ire1-alpha (IRE1a), Endoplasmic reticulum-to-nucleus signaling 1 (ERN1), and Serine/threonine-protein kinase/endoribonuclease IRE1, contains 1 KEN domain and 1 protein kinase domain. IRE1p has an

Immunogen Recombinant protein corresponding to microtubule associated serine/threonine kinase 1 Sequence LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

MIXL1 is also known as Homeobox protein MIXL1, Homeodomain protein MIX (hMix), MIX1 homeobox-like protein 1, and Mix.1 homeobox-like protein.

Twinfilin actin binding protein 1 (TWF1) belongs to the actin depolymerizing factor homology (ADF-H) family. It is expressed in non-muscle tissues.

Purified mouse monoclonal antibody. Recognizes the ~90 kDa UHRF1 protein.

Goat Anti-Mouse IgG F(ab')2 antibody Fluorescein (FITC) conjugated, pAb. This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting.

Goat Anti-Mouse IgG F(ab')2 antibody Peroxidase (Horseradish) conjugated, pAb. MOUSE IgG F(ab')2 (GOAT) Antibody is generated in goat detects specifically Mouse IgG F(ab')2 fragment.

Goat Anti-Mouse IgG F(c) antibody Peroxidase (Horseradish) conjugated, pAb. Anti-Mouse IgG F(c) fragment antibody generated in goat detects specifically Mouse IgG F(c) fragment.

HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: E, WB, IHC-P, IF APPLICATIONS: Grik1 antibody can be used for detection of Grik1 by Western blot at 0.5 - 2 &#956g/mL.

HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: E, WB, IHC-P, IF APPLICATIONS: Grik1 antibody can be used for detection of Grik1 by Western blot at 0.5 - 1 &#956g/mL.