-
Add to Cart The item has been addedHPA013388-25ULANTI-TBC1D15
Price: $540.00List Price: $600.00Immunogen TBC1 domain family member 15 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA078644-100ULAnti-TBR1 (C15-1467-182)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to T-box, brain 1 Sequence LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA078657-100ULAnti-TBR1 (C15-1467-183)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to T-box, brain 1 Sequence LLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedZ03414-100B7-H2/ICOSLG Fc Chimera, Human, 100ug
Price: $483.28List Price: $536.98B7-H2, best known as the ligand of inducible co-stimulator, belongs to B7-CD28 family. B7-H2 is a transmembrane glycoprotein of approximately 60 kDa and is expressed on antigen presenting cells such as B cells, macrophages, dendritic cells, and also -
Add to Cart The item has been addedZ03414-1B7-H2/ICOSLG Fc Chimera, Human, 1mg
Price: $2,081.82List Price: $2,313.13B7-H2, best known as the ligand of inducible co-stimulator, belongs to B7-CD28 family. B7-H2 is a transmembrane glycoprotein of approximately 60 kDa and is expressed on antigen presenting cells such as B cells, macrophages, dendritic cells, and also -
Add to Cart The item has been added20019CFr488A Goat Anti-Rabbit IgG (H+L), highly cross-adsorbed, 0
Price: $455.25List Price: $505.84This product is prepared by labeling highly cross-adsorbed goat anti-rabbit IgG (H+L) with a selection of our bright and photostable CF® dyes and other labels. To minimize cross-reactivity, the antibody has been adsorbed against human, mouse, -
Add to Cart The item has been addedA10069Chicken Anti-Human IgG (H and L) (TR),pAb,1mg
Price: $288.04List Price: $320.04Chicken Anti-Human IgG (H&L) antibody Texas Red® conjugated, pAb. This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. -
Add to Cart The item has been addedA10202Chicken Anti-Rabbit IgG (H and L) (HRP),pAb,1mg
Price: $324.77List Price: $360.86Chicken Anti-Rabbit IgG (H&L) antibody Peroxidase (Horseradish) conjugated, pAb. Anti-Rabbit IgG whole molecule antibody generated in chicken detects specifically Rabbit IgG whole molecule. -
-
Add to Cart The item has been addedA10011Goat Anti-Dog IgG F(c) (TR),pAb,2mg
Price: $313.14List Price: $347.94Goat Anti-Dog IgG F(c) antibody Texas Red® conjugated, pAb. This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. -
Add to Cart The item has been addedA10263Goat Anti-Mouse IgG F(ab)2 (HRP),pAb,500ug
Price: $324.77List Price: $360.86Goat Anti-Mouse IgG F(ab')2 antibody Peroxidase (Horseradish) conjugated, pAb. F(ab')2 Anti-Mouse IgG F(ab')2 fragment generated in goat detects specifically Mouse IgG F(ab')2 fragment. -
Add to Cart The item has been addedA10266Goat Anti-Mouse IgG F(c) (RPE),pAb,500ug
Price: $510.36List Price: $567.06Goat Anti-Mouse IgG F(c) antibody R-Phycoerythrin (RPE) conjugated, pAb. F(ab')2 anti-Mouse IgG F(c) antibody generated in goat detects specifically Mouse IgG F(c) fragment.
