-
Add to Cart The item has been addedAP1138-50UGAnti-ARSA Mouse pAb (C15-1319-081)
Price: $745.89List Price: $828.76Anti-ARSA, mouse polyclonal, recognizes the ~55 kDa ARSA protein in human lymph node tissue. It is validated for Western blotting and paraffin sections. -
Add to Cart The item has been addedHPA072496-100ULAnti-PIH1D3
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to PIH1 domain containing 3 Sequence MDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been added4978499Magnetic Stirrer Fleas, Pkg.6
Price: $244.37List Price: $271.52Magnetic stirrer fleas -
Add to Cart The item has been added10350OneTouch Barrier Tip, 200æl (1-330æl), Natural, Polypropylen (C08-0357-459)
Price: $145.44List Price: $161.60The best tips for single and multi-channel pipettors - just OneTouch&trade to seal. OneTouch tips create a leak-proof seal Minimal force required to eject tip Ideal for multi-channel pipettors Certified RNase/DNase-free Top collar color-coded by -
Add to Cart The item has been added10350OneTouch Barrier Tip, 200æl (1-330æl), Natural, Polypropylen (C08-0357-539)
Price: $533.27List Price: $592.53The best tips for single and multi-channel pipettors - just OneTouch&trade to seal. OneTouch tips create a leak-proof seal Minimal force required to eject tip Ideal for multi-channel pipettors Certified RNase/DNase-free Top collar color-coded by -
Add to Cart The item has been added559309-10TPhosphoDetect Anti-SAPK/JNK (pThr¹⁸³, Tyr¹⁸⁵) Rabbit pAb (C15-1305-728)
Price: $1,059.43List Price: $1,177.14Rabbit polyclonal antibody adsorbed against non-phosphopeptide corresponding to the immunogen phosphorylation site, followed by immunoaffinity chromatography. Recognizes the ~49 kDa JNK1/SAPK1 protein and the ~55 kDa JNK2/SAPK2 protein -
-
Add to Cart The item has been addedAPrEST70807-100PrEST Antigen PI3 peptidase inhibitor 3, skin-derived, 100ul
Price: $537.65List Price: $597.39PrEST Antigen PI3 peptidase inhibitor 3, skin-derived, 100ul
