-
HPA068508-100UL
Anti-DIRC1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to disrupted in renal carcinoma 1 Sequence EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
1213622
Capsule Filter, PP, 10æm, 1/4 Nptm, 1/Pk
Price: $238.24List Price: $264.71All capsules containing membrane media are preflushed with purified water to reduce extractable. GVS capsules made with Polypropylene housings are food compliant (FDA/EU), as restrictions may apply depending on the final application, it is the end -
APrEST79539-100
PrEST Antigen ANKUB1 ankyrin repeat and ubiquitin domain con
Price: $537.65List Price: $597.39PrEST Antigen ANKUB1 ankyrin repeat and ubiquitin domain con -
APrEST92355-100
PrEST Antigen PHLDA1 pleckstrin homology-like domain, family (C08-0224-604)
Price: $537.65List Price: $597.39PrEST Antigen PHLDA1 pleckstrin homology-like domain, family -
APrEST77082-100
PrEST Antigen PHLDA3 pleckstrin homology-like domain, family
Price: $537.65List Price: $597.39PrEST Antigen PHLDA3 pleckstrin homology-like domain, family -
APrEST94422-100
PrEST Antigen PLEKHB2 pleckstrin homology domain containing
Price: $537.65List Price: $597.39PrEST Antigen PLEKHB2 pleckstrin homology domain containing -
APrEST81908-100
PrEST Antigen SLURP1 secreted LY6/PLAUR domain containing 1,
Price: $537.65List Price: $597.39PrEST Antigen SLURP1 secreted LY6/PLAUR domain containing 1,