Terfenadine

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

Tight junction protein 1/Zona occludens 1 protein (TJP1, ZO-1) is a membrane-associated guanylate kinase, associated with cytoplasmic membrane surface of intercellular tight junctions. ZO-1 gene is mapped to human chromosome 15q13.

Immunogen Recombinant protein corresponding to talin 2 Sequence AADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Recombinant protein corresponding to talin 2 Sequence IEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQALHDLLQHVRQFASRG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

N,N,N&#39,N&#39-Tetramethylethylenediamine is used to catalyze the formation of free radicals from ammonium persulfate or riboflavin. The free radicals will cause acrylamide and bis-acrylamide to polymerize to form a gel matrix which can be used