-
Add to Cart The item has been addedABN2266Anti-Tentonin 3/TMEM150c (C15-1317-504)
Price: $653.06List Price: $725.62Transmembrane protein 150C (UniProt: Q8C8S3 also known as Tentonin, TTN3) is encoded by the Tmem150c gene (Gene ID: 231503) in murine species. TTN3 is a multi-pass membrane protein of the DRAM/TMEM150 family. -
Add to Cart The item has been addedABN2266-25ULAnti-Tentonin 3/TMEM150c (C15-1317-505)
Price: $307.10List Price: $341.22Transmembrane protein 150C (UniProt: Q8C8S3 also known as Tentonin, TTN3) is encoded by the Tmem150c gene (Gene ID: 231503) in murine species. TTN3 is a multi-pass membrane protein of the DRAM/TMEM150 family. -
Add to Cart The item has been addedHPA029518-25ULANTI-TGM2
Price: $540.00List Price: $600.00Immunogen transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed -
Add to Cart The item has been addedHPA072934-100ULAnti-TMPRSS15
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to transmembrane protease, serine 15 Sequence LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK Application All Prestige Antibodies Powered by Atlas Antibodies are -
-
-
-
Add to Cart The item has been added1519130001PUROSTAR NH2 5MYM HI-RT 250-4.6
Price: $920.98List Price: $1,023.31Purospher ® STAR NH2, 5 µm HPLC columns are widely used for carbohydrate analysis, with a typical mobile phase consisting of acetonitrile and water. In terms of their polarity, these columns lie between bare silica and reversed-phase silica. -
Add to Cart The item has been added1Stopper, No. 1
Price: $26.94List Price: $29.94Free from volatiles or extractable substances which may impair cell growth for use at temperatures from -80 to 450°F Can be steam sterilized at 15 lbs. pressure, making them suitable for culture tubes containing pathogenic materials Length: 25 -
Add to Cart The item has been added3Stopper, No. 3
Price: $35.74List Price: $39.71Free from volatiles or extractable substances which may impair cell growth for use at temperatures from -80 to 450°F Can be steam sterilized at 15 lbs. pressure, making them suitable for culture tubes containing pathogenic materials Length: 25
