Antineoplastic agents

Immunogen beaded filament structural protein 2, phakinin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to barttin CLCNK type accessory beta subunit Sequence QPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACS Application All Prestige Antibodies Powered by Atlas Antibodies

Expansion of a GGGGCC (G4C2) hexanucleotide repeat sequence in the non-coding region of human chromosome 9 open reading frame 72 or C9orf72 (also known as ALSFTD, FTDALS Gene ID 203228) is the most common genetic abnormality in familial and

CALB1 (calbindin 1) is a member of the EF-hand family of calcium-binding proteins. It is mainly present in the cerebellum.

Immunogen Caldesmon recombinant protein epitope signature tag (PrEST) Application Anti-CALD1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by

Calretinin (UniProt: P47728 also known as CR) is encoded by the Calb2 gene (Gene ID: 117059) in rat. Calretinin belongs to the calbindin protein family and acts as a calcium-binding protein.

Calretinin (UniProt: P47728 also known as CR) is encoded by the Calb2 gene (Gene ID: 117059) in rat. Calretinin belongs to the calbindin protein family and acts as a calcium-binding protein.

CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5 also known as SaCas9, Cas9) is encoded by the Cas9 gene in Streptococcus aureus. Cas9 belongs to subtype II-A subfamily with one HNH Cas9-type domain.

CD34 (cluster of differentiation 34) molecule, a cell surface antigen, is expressed in hematopoietic stem cells and vascular endothelium. This gene is 26&#160kb in length and contain 8 exons.

Cyclin-dependent kinase 12 (CDK12) is a member of the cyclin-dependent kinase (CDK) family of serine/threonine protein kinases. It is located at 17q12 on the human chromosome.

Cyclin-dependent kinase 13 (UniProt: Q14004: also known as Cdk13, EC:2.7.

CDK14 (cyclin-dependent kinase 14) belongs to a 21 member cyclin dependent kinase gene family. It is also called PFTK1 or PFTAIRE1.