Antineoplastic agents

Immunogen cyclin-dependent kinase 20 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen cyclin-dependent kinase inhibitor 1A (p21, Cip1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Cyclin-dependent kinase inhibitor 1C recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Recombinant protein corresponding to CDP-diacylglycerol synthase 1 Sequence PREAVSPPHREGEAAGGDHETESTSDKETDIDDRYGDLDSRTDSDIPEIPPSSDRTPEILKKALSGLSSR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen centromere protein N Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Centrosomal protein of 152 kDa (UniProt O94986 also known as Cep152) is encoded by the CEP152 (also known as KIAA0912) gene (Gene ID 22995) in human. The mammalian Asl (Asterless) ortholog Cep152 is a centrosomal protein (CEP) that plays an

Immunogen centrin, EF-hand protein, 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen centrin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to cilia and flagella associated protein 53 Sequence QETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKD Application All Prestige Antibodies Powered by Atlas

Immunogen Synthetic peptide directed towards the N terminal region of human CLEC4M Biochem/physiol Actions CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209,

Immunogen COMM domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to copine 4 Sequence AEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,