Antineoplastic agents

Immunogen erb-b2 receptor tyrosine kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen erb-b2 receptor tyrosine kinase 2 Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper) Biochem/physiol Actions Receptor

ERLIN2 (ER lipid raft associated 2), a member of prohibitin family of protein, was first identified in hematopoietic cells. It consists of a conserved prohibitin-homology domain (PHB).

Immunogen FAS-associated factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to family with sequence similarity 92 member A Sequence VERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSDRHVISQAETELQRAAMDASRTSRHLE Application All Prestige Antibodies Powered by Atlas Antibodies are

Facio-genital dysplasia protein (FGD1) is an upstream regulator of Rho GTPases and is involved in the normal development of embryos . It is also known to function as a guanine-nucleotide exchange factor which is specific for Cdc42Hs .

Immunogen FYVE, RhoGEF and PH domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Recombinant protein corresponding to fibroblast growth factor 11 Sequence VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to fibroblast growth factor 11 Sequence VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to fibroblast growth factor 9 Sequence MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen Fos-related antigen 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

The protein called Friend of PRMT1 (FOP), or more correctly Chromatin target of PRMT1 protein, or Small arginine and glycine rich protein (SRAG) is an important partner in estrogen receptor gene activation events and plays a role in 5FMC mediated