Antineoplastic agents

Immunogen frizzled class receptor 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen gamma-aminobutyric acid (GABA) A receptor, beta 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Galactocerebroside is the major galactosphingolipid of myelin. It is expressed in the CNS in cell membranes of oligodendrocytes.

Immunogen Recombinant protein corresponding to galactose mutarotase Sequence DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Recombinant protein corresponding to galactosamine (N-acetyl)-6-sulfatase Sequence TTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKK Application All Prestige Antibodies Powered by Atlas Antibodies

GALNT13 is particularly expressed in fetal brain, adult cerebellum, cerebral cortex and whole brain. GALNT13 transcripts are exclusively present in neuroblastoma cells.

GALNT2 (polypeptide N -acetylgalactosaminyltransferase 2) belongs to the ppGalNAc-T family, and is a type II transmembrane protein. The catalytic domain resides in the Golgi luminal region, and the R-type lectin domain lies in the C-terminal.

Immunogen polypeptide N-acetylgalactosaminyltransferase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen polypeptide N-acetylgalactosaminyltransferase 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Specificity Note: The Ensemble Gene ID has changed from ENSG00000137070 in the 46:36 release of the database to ENSG00000213930 in the 48:36 release of the database. Immunogen Galactose-1-phosphate uridylyltransferase recombinant protein epitope

Anti-Ganglioside GM&#8321, rabbit polyclonal, recognizes ganglioside GM&#8321. Cross-reacts slightly with asialo-GM&#8321.

Anti-Ganglioside GM&#8321, Asialo, rabbit polyclonal, recognizes ganglioside GM&#8321 asialo. Rabbit polyclonal antibody supplied as undiluted serum.