-
Add to Cart The item has been addedHPA070916-25ULANTI-KIAA0196
Price: $540.00List Price: $600.00Immunogen WASH complex subunit 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedAV48767-100ULANTI-LCMT2
Price: $898.29List Price: $998.10LCMT2 codes for leucine carboxyl methyltransferase 2 that belongs to the variable methyltransferase superfamily. Rabbit anti-LCMT2 antibody recognizes canine, human, and chicken LCMT2. -
Add to Cart The item has been addedHPA000687-100ULAnti-LGALS1 (C15-1445-023)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to lectin, galactoside-binding, soluble,1. Sequence LKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDF Application All Prestige Antibodies -
Add to Cart The item has been addedHPA001130-100ULAnti-LGALS1 (C15-1445-173)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to lectin, galactoside-binding, soluble, 1. Sequence EVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCV Application All Prestige Antibodies -
Add to Cart The item has been addedAV46789-100ULANTI-LMAN2
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the C terminal region of human LMAN2 Application Anti-LMAN2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL. -
Add to Cart The item has been addedHPA077070-100ULAnti-LMTK3
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to lemur tyrosine kinase 3 Sequence CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA013170-25ULANTI-LPAR5
Price: $540.00List Price: $600.00Immunogen Lysophosphatidic acid receptor 5 (LPA receptor 5) (LPA-5) (G-protein coupled receptor 92) (G-protein coupled receptor 93) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA005653-25ULANTI-MAFB
Price: $540.00List Price: $600.00Musculoaponeurotic fibrosarcoma oncogene homolog B (MafB) is a transcription factor which is present in a wide variety of tissues and has 311 amino acids containing a typical bZip motif in its carboxy-terminal region. Immunogen Transcription factor -
Add to Cart The item has been addedHPA059977-100ULAnti-MAMDC4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen MAM domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA003923-100ULAnti-MAMLD1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen mastermind-like domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been added444105-100UGAnti-Mannose 6-Phosphate Receptor Mouse mAb (2G11) (C15-1303-618)
Price: $786.60List Price: $874.00Purified mouse monoclonal antibody. Recognizes the mannose 6-phosphate receptor protein. -
Add to Cart The item has been addedHPA038149-25ULANTI-MAP4
Price: $540.00List Price: $600.00Immunogen microtubule-associated protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
