Antineoplastic agents

Immunogen mitogen-activated protein kinase 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen MOCO sulphurase C-terminal domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Macrophage receptor MARCO (UniProt: Q9UEW3 also known as macrophage receptor with collagenous structure Scavenger receptor class A member 2) is encoded by the MARCO (also known as SCARA2) gene (Gene ID: 8685) in human. MARCO is strongly expressed

The gene MCOLN1 (mucolipin-1) is mapped to human chromosome 19p13. The encoded protein is mainly present within late endosomes/lysosomes.

Methyl-CpG-binding protein 2 (UniProt P51608 also known as MeCp-2 protein, MeCp2) is encoded by the MECP2 (also known as AS, MRXS13, MRXSL, PPMX, RTT, AUTSX3) gene (Gene ID 4204) in human. Methyl-CpG-binding proteins that are involved in gene

Immunogen Mediator of RNA polymerase II transcription subunit 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Methyltransferase like 21B (METTL21B), also known as EEF1A lysine methyltransferase 3 (EEF1AKMT3), belongs to the methyltransferase family 16 (MTF16). It is encoded by the gene mapped to human chromosome 12q13.

METTL2B codes for methyltransferase like 2B that is involved in tRNA methylation. Rabbit Anti-METTL2B antibody recognizes human, mouse, rat, canine, zebrafish, and bovine METTL2B.

Immunogen methyltransferase like 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to O-6-methylguanine-DNA methyltransferase Sequence KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Mitofilin, also known as heart muscle protein, is a recently identified mitochondrial protein. Mitofilin associates only with mitochondria and not with other membrane-bounded organelles such as Golgi or endoplasmic reticulum.

Immunogen Synthetic peptide directed towards the N terminal region of human MMP23B Application Anti-MMP23B antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/mL. Biochem/physiol Actions MMP23B (matrix